GET /api/protein/UniProt/Q90029/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q90029",
"id": "KITH_RACVI",
"source_organism": {
"taxId": "10256",
"scientificName": "Raccoon poxvirus",
"fullName": "Raccoon poxvirus (RCN)"
},
"name": "Thymidine kinase",
"description": [
"Phosphorylates thymidine and thymidine analogs, such as azidothymidine (AZT). Part of the salvage pathway for pyrimidine deoxyribonucleotide synthesis"
],
"length": 177,
"sequence": "MNGGHIQLIIGPMFSGKSTELIRRVRRYQIAQYKCITIKYTNDTRYGTGLWTHDKHNFSAMETTKLLNIIDAVTDFSVIGIDEGQFFPDIVEFCEYMANNGKIVIVAALDGTFQRKPFTTISNLIPLSEMVVKLTAVCMKCFKEASFSKRLGTETEIEIIGGEDMYQSVCRKCYINE",
"proteome": null,
"gene": "OPG101",
"go_terms": [
{
"identifier": "GO:0004797",
"name": "thymidine kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "712fb282f9c0f6cc2387eb974ce8eaa782199f1a",
"counters": {
"domain_architectures": 19474,
"entries": 11,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"panther": 1,
"pfam": 1,
"pirsf": 1,
"prosite": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 19474
}
}
}