General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q8ZMD3",
        "id": "QUEF_SALTY",
        "source_organism": {
            "taxId": "99287",
            "scientificName": "Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)",
            "fullName": "Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)"
        },
        "name": "NADPH-dependent 7-cyano-7-deazaguanine reductase",
        "description": [
            "Catalyzes the NADPH-dependent reduction of 7-cyano-7-deazaguanine (preQ0) to 7-aminomethyl-7-deazaguanine (preQ1)"
        ],
        "length": 282,
        "sequence": "MSSYENHQALDGLTLGKSTDYRDNYDVSLLQGVPRSLNRDPLGLTADNLPFHGADIWTLYELSWLNSQGLPQVAVGHVELDYTSVNLIESKSFKLYLNSFNQTRFDTWETVRQTLERDLRACAQGNVSVRLHRLDELEGQPVAHFHGTCIDDQDISIDNYQFTTDYLQHAVSGEKQVEETLVSHLLKSNCLITHQPDWGSIQIQYRGRKIDREKLLRYLVSFRHHNEFHEQCVERIFNDILRFCQPETLSVYARYTRRGGLDINPWRSNTDFVPATGRLARQ",
        "proteome": "UP000001014",
        "gene": "queF",
        "go_terms": [
            {
                "identifier": "GO:0008616",
                "name": "tRNA queuosine(34) biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0046857",
                "name": "oxidoreductase activity, acting on other nitrogenous compounds as donors, with NAD or NADP as acceptor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b826c406e709a9d74856e11f2b2aa8f9900af214",
        "counters": {
            "domain_architectures": 6229,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "cathgene3d": 1,
                "ssf": 1,
                "hamap": 1,
                "pirsf": 1,
                "ncbifam": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 6229
        }
    }
}