GET /api/protein/UniProt/Q8Z8C7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q8Z8C7",
        "id": "Q8Z8C7_SALTI",
        "source_organism": {
            "taxId": "90370",
            "scientificName": "Salmonella typhi",
            "fullName": "Salmonella typhi"
        },
        "name": "Succinate dehydrogenase iron-sulfur subunit",
        "description": [
            "Two distinct, membrane-bound, FAD-containing enzymes are responsible for the catalysis of fumarate and succinate interconversion; the fumarate reductase is used in anaerobic growth, and the succinate dehydrogenase is used in aerobic growth"
        ],
        "length": 239,
        "sequence": "MMKLEFSIYRYNPDVDNAPRMQDYTLEGEEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALTQSGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLEGMSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRSA",
        "proteome": "UP000002670",
        "gene": "sdhB",
        "go_terms": [
            {
                "identifier": "GO:0051536",
                "name": "iron-sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009055",
                "name": "electron transfer activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006099",
                "name": "tricarboxylic acid cycle",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e3c13263eee326ff8609d36a527989825e0a205f",
        "counters": {
            "domain_architectures": 12687,
            "entries": 21,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 2,
                "ssf": 2,
                "cathgene3d": 2,
                "pfam": 2,
                "ncbifam": 2,
                "panther": 1,
                "prosite": 1,
                "interpro": 9
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 12687
        }
    }
}