General Handler

HTTP 200 OK
Allow: GET, HEAD
Cached: true
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Server-Timing: 
Vary: Accept

{
    "metadata": {
        "accession": "Q8Z587",
        "id": "Q8Z587_SALTI",
        "source_organism": {
            "taxId": "90370",
            "scientificName": "Salmonella typhi",
            "fullName": "Salmonella typhi"
        },
        "name": "Lipid A 1-diphosphate synthase",
        "description": [
            "Involved in the modification of the lipid A domain of lipopolysaccharides (LPS). Transfers a phosphate group from undecaprenyl pyrophosphate (C55-PP) to lipid A to form lipid A 1-diphosphate. Contributes to the recycling of undecaprenyl phosphate (C55-P)"
        ],
        "length": 239,
        "sequence": "MTMKTRYSLIILLNAAGLALFLSWYLPVNHGFWFTIDSGIFHFFNQKLVESHAFLWWVAITNNRAFDGCSLLAMGGLMLSFWLKEDASGRRRIVIIGLVMLLTAVVLNQLGQALIPVKRASPTLSFEHIYRVSELLHIPTKDASKDSFPGDHGMMLLIFSAFMLRYFGKTAGIIALIIFVVFAFPRVMIGAHWFTDIVVGSLTVILIGLPWWLMTPLSDRAIALFEDYLPGGNKQILNK",
        "proteome": "UP000002670",
        "gene": "lpxT",
        "go_terms": [
            {
                "identifier": "GO:0050380",
                "name": "undecaprenyl-diphosphatase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0043165",
                "name": "Gram-negative-bacterium-type cell outer membrane assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005886",
                "name": "plasma membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ff308a62e727406a341790172e35cf62f6fc2c9c",
        "counters": {
            "domain_architectures": 108244,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cdd": 1,
                "smart": 1,
                "hamap": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 108244
        }
    }
}