General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q8Y825",
        "id": "NADE_LISMO",
        "source_organism": {
            "taxId": "169963",
            "scientificName": "Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)",
            "fullName": "Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)"
        },
        "name": "NH(3)-dependent NAD(+) synthetase",
        "description": [
            "Catalyzes the ATP-dependent amidation of deamido-NAD to form NAD. Uses ammonia as a nitrogen source"
        ],
        "length": 274,
        "sequence": "MEIRERILADMQVAETIDAHEEIRKSVEFLKAYLKKNTFLKSFVLGISGGQDSTLTGKLAQMAISEMRAETGDDEYRFFAVSLPYGTQLDESDRQDALNFMEPDNRLTVNIKASVDASVAALAEAGVELSDFAKGNEKARERMKVQYAIAAMHKGVVVGTDHSAEAVTGFYTKYGDGGTDINPLFRLNKRQGKALLKELGCPEHLYLKKPTADLEDNKPALPDEVALGVTYDQIDDYLEGKEVPADAAAKIENWFIKTEHKRHMAITIFDDFWK",
        "proteome": "UP000000817",
        "gene": "nadE",
        "go_terms": [
            {
                "identifier": "GO:0003952",
                "name": "NAD+ synthase (glutamine-hydrolyzing) activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004359",
                "name": "glutaminase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009435",
                "name": "NAD+ biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0008795",
                "name": "NAD+ synthase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "df0196eb003d134d3434ad5c74e1b303ecce340b",
        "counters": {
            "domain_architectures": 17180,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "ncbifam": 2,
                "panther": 1,
                "hamap": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 17180
        }
    }
}