HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q8WEQ4",
"id": "Q8WEQ4_CANCA",
"source_organism": {
"taxId": "51854",
"scientificName": "Candoia carinata",
"fullName": "Candoia carinata (Papuan tree boa)"
},
"name": "Cytochrome b",
"description": [
"Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex) that is part of the mitochondrial respiratory chain. The b-c1 complex mediates electron transfer from ubiquinol to cytochrome c. Contributes to the generation of a proton gradient across the mitochondrial membrane that is then used for ATP synthesis"
],
"length": 90,
"sequence": "FGSMLLTCSTLQVTTGFFLSMHYTANINLAFSSIIHITRDVPHGWMMQNLHAIGASVFFICIYTHIARGLYYGSYLNKETWLSGTTLLIM",
"proteome": null,
"gene": null,
"go_terms": [
{
"identifier": "GO:0009055",
"name": "electron transfer activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0022904",
"name": "respiratory electron transport chain",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "be34220e9275984b10f29960f25876d49b60ca7d",
"counters": {
"domain_architectures": 86317,
"entries": 8,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"profile": 1,
"cathgene3d": 1,
"ssf": 1,
"panther": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 86317
}
}
}