GET /api/protein/UniProt/Q8VZD4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q8VZD4",
"id": "DEG15_ARATH",
"source_organism": {
"taxId": "3702",
"scientificName": "Arabidopsis thaliana",
"fullName": "Arabidopsis thaliana (Mouse-ear cress)"
},
"name": "Glyoxysomal processing protease, glyoxysomal",
"description": [
"Trypsin-like serine endopeptidase involved in the processing of glyoxysomal higher molecular weight precursor. The dimeric form carries out the specific cleavages needed to remove PTS2-containing presequences, whereas the monomeric form degrades the removed presequences and misfolded proteins (Probable). Not required for degradation of glyoxylate cycle enzymes during seedling development"
],
"length": 709,
"sequence": "MDVSKVVSFSRNFAVLVKVEGPDPKGLKMRKHAFHQYHSGNATLSASGILLPRDIFLSGEVAAKVLFEAGQDMALVLTVASVVEPFLTLGHRTSSSISQDPVKLIPGAMIEIMVEGQLKSEKEAPFWVPAQLLSLVDVPVSSAALQSLIEASSGSKDSGWDIGWSLVSAANGSQPSINIEHYSKPLMQLDEPHNANFMAKSATRMAILGVPLSLLGQPSMNFASSSSKGDTLVALGSPFGILSPVNFFNSVSTGSIANSYPSGSLKKSLMIADVRCLPGMEGAPVFAKNGHLIGILIRPLRQKNSGVEIQLVVPWGAITTACSHLLLEEPSVEGKASQWGSEVLSVKSDASIPAQVAIEKAMESVCLITVNDGVWASGIILNEHGLILTNAHLLEPWRYGKGGVYGEGFKPYVLGAEEFSSTGSKFWEQKSQTLPRKAPRNHYSSVGENIREYKHNFLQTGHRDIRVRLCHLDSWTWCPANVVYICKEQLDIALLQLEYVPGKLQPITANFSSPPLGTTAHVVGHGLFGPRCGLSPSICSGVVAKVVHAKRRLNTQSISQEVAEFPAMLETTAAVHPGGSGGAVLNSSGHMIGLVTSNARHGAGTVIPHLNFSIPCAVLAPIFKFAEDMQNTTILQTLDQPSEELSSIWALMPSLSPKTEQSLPNLPKLLKDGNNKQTKGSQFAKFIAETQDMFVKPTKLSRDVIPSKL",
"proteome": "UP000006548",
"gene": "DEG15",
"go_terms": [
{
"identifier": "GO:0004252",
"name": "serine-type endopeptidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016485",
"name": "protein processing",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005777",
"name": "peroxisome",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5e9fc0377242de055e88686a42690af967c63635",
"counters": {
"domain_architectures": 797,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"ssf": 1,
"cathgene3d": 1,
"panther": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 797
}
}
}