GET /api/protein/UniProt/Q8VZD4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q8VZD4",
        "id": "DEG15_ARATH",
        "source_organism": {
            "taxId": "3702",
            "scientificName": "Arabidopsis thaliana",
            "fullName": "Arabidopsis thaliana (Mouse-ear cress)"
        },
        "name": "Glyoxysomal processing protease, glyoxysomal",
        "description": [
            "Trypsin-like serine endopeptidase involved in the processing of glyoxysomal higher molecular weight precursor. The dimeric form carries out the specific cleavages needed to remove PTS2-containing presequences, whereas the monomeric form degrades the removed presequences and misfolded proteins (Probable). Not required for degradation of glyoxylate cycle enzymes during seedling development"
        ],
        "length": 709,
        "sequence": "MDVSKVVSFSRNFAVLVKVEGPDPKGLKMRKHAFHQYHSGNATLSASGILLPRDIFLSGEVAAKVLFEAGQDMALVLTVASVVEPFLTLGHRTSSSISQDPVKLIPGAMIEIMVEGQLKSEKEAPFWVPAQLLSLVDVPVSSAALQSLIEASSGSKDSGWDIGWSLVSAANGSQPSINIEHYSKPLMQLDEPHNANFMAKSATRMAILGVPLSLLGQPSMNFASSSSKGDTLVALGSPFGILSPVNFFNSVSTGSIANSYPSGSLKKSLMIADVRCLPGMEGAPVFAKNGHLIGILIRPLRQKNSGVEIQLVVPWGAITTACSHLLLEEPSVEGKASQWGSEVLSVKSDASIPAQVAIEKAMESVCLITVNDGVWASGIILNEHGLILTNAHLLEPWRYGKGGVYGEGFKPYVLGAEEFSSTGSKFWEQKSQTLPRKAPRNHYSSVGENIREYKHNFLQTGHRDIRVRLCHLDSWTWCPANVVYICKEQLDIALLQLEYVPGKLQPITANFSSPPLGTTAHVVGHGLFGPRCGLSPSICSGVVAKVVHAKRRLNTQSISQEVAEFPAMLETTAAVHPGGSGGAVLNSSGHMIGLVTSNARHGAGTVIPHLNFSIPCAVLAPIFKFAEDMQNTTILQTLDQPSEELSSIWALMPSLSPKTEQSLPNLPKLLKDGNNKQTKGSQFAKFIAETQDMFVKPTKLSRDVIPSKL",
        "proteome": "UP000006548",
        "gene": "DEG15",
        "go_terms": [
            {
                "identifier": "GO:0004252",
                "name": "serine-type endopeptidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016485",
                "name": "protein processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005777",
                "name": "peroxisome",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5e9fc0377242de055e88686a42690af967c63635",
        "counters": {
            "domain_architectures": 797,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 797
        }
    }
}