General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q8VDQ1",
        "id": "PTGR2_MOUSE",
        "source_organism": {
            "taxId": "10090",
            "scientificName": "Mus musculus",
            "fullName": "Mus musculus (Mouse)"
        },
        "name": "Prostaglandin reductase 2",
        "description": [
            "Functions as 15-oxo-prostaglandin 13-reductase and acts on 15-keto-PGE1, 15-keto-PGE2, 15-keto-PGE1-alpha and 15-keto-PGE2-alpha with highest activity towards 15-keto-PGE2. Overexpression represses transcriptional activity of PPARG and inhibits adipocyte differentiation"
        ],
        "length": 351,
        "sequence": "MIIQRVVLNSRPGKNGNPVAENFRVEEFSLPDALNEGQVQVRTLYLSVDPYMRCKMNEDTGTDYLAPWQLAQVADGGGIGVVEESKHQKLTKGDFVTSFYWPWQTKAILDGNGLEKVDPQLVDGHLSYFLGAIGMPGLTSLIGVQEKGHISAGSNQTMVVSGAAGACGSLAGQIGHLLGCSRVVGICGTQEKCLFLTSELGFDAAVNYKTGNVAEQLREACPGGVDVYFDNVGGDISNAVISQMNENSHIILCGQISQYSNDVPYPPPLPPAVEAIRKERNITRERFTVLNYKDKFEPGILQLSQWFKEGKLKVKETMAKGLENMGVAFQSMMTGGNVGKQIVCISEDSSL",
        "proteome": "UP000000589",
        "gene": "Ptgr2",
        "go_terms": [
            {
                "identifier": "GO:0047522",
                "name": "15-oxoprostaglandin 13-reductase [NAD(P)+] activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006693",
                "name": "prostaglandin metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016628",
                "name": "oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5868aa2108b93d49c5c92d05158401122f1a86a6",
        "counters": {
            "domain_architectures": 28175,
            "entries": 14,
            "isoforms": 2,
            "proteomes": 1,
            "sets": 3,
            "structures": 2,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cdd": 1,
                "cathgene3d": 2,
                "pfam": 2,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 28175
        }
    }
}