GET /api/protein/UniProt/Q8V3F7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q8V3F7",
"id": "Q8V3F7_SWPV1",
"source_organism": {
"taxId": "300880",
"scientificName": "Swinepox virus (strain Swine/Nebraska/17077-99/1999)",
"fullName": "Swinepox virus (strain Swine/Nebraska/17077-99/1999) (SWPV)"
},
"name": "Complement control protein C3",
"description": [
"Serves to protect the virus against complement attack by inhibiting both classical and alternative pathways of complement activation. Binds C3b and C4b"
],
"length": 232,
"sequence": "MLLSLFILMYYMPNVIYCSCDIPPDIVNGEIYDKKEVYSKGDSISYICGENKIGIPYSLIGNDVITCNKDGKWYPDPPRCEMIICRFPALQNGYVNGIPSNKKFYYKQKVSFTCKDGFLLAGEPYSICNINSTWFPDIPICIKNDKSLSIIIYNKNDDDFKDLDNEDIVNANMRSINNTLEINITNNNISETTLLIILGSIGSIFIFGIILLIYSCSNSVNNKYSKLDTFIT",
"proteome": "UP000000871",
"gene": "SPV139",
"go_terms": null,
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "12d720c9eb5480a153462998968e7da3ac85b69b",
"counters": {
"domain_architectures": 4243,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"ssf": 1,
"smart": 1,
"pfam": 1,
"cdd": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4243
}
}
}