General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q8UJC4",
        "id": "COAE_AGRFC",
        "source_organism": {
            "taxId": "176299",
            "scientificName": "Agrobacterium fabrum (strain C58 / ATCC 33970)",
            "fullName": "Agrobacterium fabrum (strain C58 / ATCC 33970)"
        },
        "name": "Dephospho-CoA kinase",
        "description": [
            "Catalyzes the phosphorylation of the 3'-hydroxyl group of dephosphocoenzyme A to form coenzyme A"
        ],
        "length": 194,
        "sequence": "MMIVIGLTGSIGMGKTTTAKLFAEEGVPVLDSDEVVHGLYRAEAVPLIDAAFPGTTISGMVDRQKLGDVLRKNPANFNRLEEIVHPLVRNRQEAFLAKARIDDRAFALLDIPLLFETGAEGRVDKVVVVSCAPEIQRERVLSRPGMTEEKFEMILARQMPDAEKRQRADFVVDSGNGVEAARDQVKEILQKLGA",
        "proteome": "UP000000813",
        "gene": "coaE",
        "go_terms": [
            {
                "identifier": "GO:0004140",
                "name": "dephospho-CoA kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015937",
                "name": "coenzyme A biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "49638b9f42bbff824978a79f98cc7886acc4d639",
        "counters": {
            "domain_architectures": 28647,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "profile": 1,
                "hamap": 1,
                "ncbifam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 28647
        }
    }
}