General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q8R0K2",
        "id": "TRI31_MOUSE",
        "source_organism": {
            "taxId": "10090",
            "scientificName": "Mus musculus",
            "fullName": "Mus musculus (Mouse)"
        },
        "name": "E3 ubiquitin-protein ligase TRIM31",
        "description": [
            "E3 ubiquitin-protein ligase that acts as a regulator of antiviral immune response and inflammation by mediating ubiquitination of substrates (PubMed:27929086, PubMed:27992402). Acts as a regulator of innate immune defense against viruses by mediating 'Lys-63'-linked ubiquitination of MAVS, promoting MAVS polymerization and formation of three-stranded helical filaments on mitochondria (PubMed:27992402). Acts as a negative regulator of the NLRP3 inflammasome by catalyzing 'Lys-48'-linked ubiquitination of NLRP3, leading to its degradation (PubMed:27929086). Regulator of Src-induced anchorage independent cell growth (PubMed:19665990)"
        ],
        "length": 507,
        "sequence": "MAGQPLACQLQEEVTCPICMEILQDPVTIDCGHNFCLQCISQVGKTSEKIQCPLCKLSVNKNTFRPNKLLASLAEKIQSMDPADIQAEKEDSRCQRHKEKLHYFCEQDGAFLCVVCRDSKDHKSHNVTLIDEAAQNYKVQIESQAQDLGQKDKKIIEEKKQGEGAIWAFRAQVDLEKLKIHEEFKLLRQRLDEEESFLLSRLDWLEQQGAKQLRQYVTVTEKQLNSLRKLTKSLKIRLQSSSMELLKDIKDALSRGKEFQFLNPNPVPEDLEKKCSEAKARHESIIKTLTELKDDMNAEGKRDKSAFMNSLNKEEKESWSLLQKNNSVLPTSVPVTLDKSSADPDLTFSQDLKKVTLYIVAGKASNRQAKPRPFYPFHCVRGSPGLSSGRQVWEAEIRGPSGGACIVGVVTELARGAQSQTVSAQSYIWALRISPSGCQPFTNCKAQEYLQVCLKKVGVYVNHDCGEVVFYDAITSKHIYTFQTSFDGKVFPLFGLQVACSHITLSP",
        "proteome": "UP000000589",
        "gene": "Trim31",
        "go_terms": [
            {
                "identifier": "GO:0008270",
                "name": "zinc ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b44504b5a257508d5fc228c197d85e89bf3e6d55",
        "counters": {
            "domain_architectures": 697,
            "entries": 29,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "ssf": 3,
                "cdd": 1,
                "smart": 3,
                "pfam": 3,
                "profile": 3,
                "panther": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 10
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 697
        }
    }
}