GET /api/protein/UniProt/Q8QMT6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q8QMT6",
        "id": "Q8QMT6_CWPXB",
        "source_organism": {
            "taxId": "265872",
            "scientificName": "Cowpox virus (strain Brighton Red)",
            "fullName": "Cowpox virus (strain Brighton Red) (CPV)"
        },
        "name": "Virion membrane protein OPG144 precursor",
        "description": [
            "Envelope protein which participates in virus morphogenesis. Needed for an early step in viral crescent membrane formation by interacting with OPG125 scaffold protein. Its interaction with OPG125 scaffold protein leads to the formation of rigid, crescent-shaped membranes that assemble around the cytoplasmic virus factory. Acts as a membrane anchor for the protein OPG154. OPG144-OPG154 virus envelope protein might be involved in fusion or attachment, and can further associate with OPG153"
        ],
        "length": 202,
        "sequence": "MSYLRYYNMLDDFSAGAGVLDKDLFTEEQQQSFMPKDGGMMQNDYGGMNDYLGIFKNNDVRTLLGLILFVLALYSPPLISILMIFISSFLLPLTSLVITYCLVTQMYRGGNGNTVGMSIVCIVAAVIIMAINVFTNSQIFNIISYIILFILFFAYVMNIERQDYKRINITIPEHHTCNKPYNAGNKVDVDIPTFNSLNTDDY",
        "proteome": "UP000152733",
        "gene": "CPXV150 CDS",
        "go_terms": [
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "936ce9501ac373d10cdb8a82ced0a8e350d3daaa",
        "counters": {
            "domain_architectures": 124,
            "entries": 2,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 124
        }
    }
}