General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q8PV36",
        "id": "RS14Z_METMA",
        "source_organism": {
            "taxId": "192952",
            "scientificName": "Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)",
            "fullName": "Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)"
        },
        "name": "Small ribosomal subunit protein uS14",
        "description": [
            "Binds 16S rRNA, required for the assembly of 30S particles"
        ],
        "length": 50,
        "sequence": "MTDSIDKSGRGVNECKRCGRKQGLVRKYDIYLCRHCFREIAHEMGFEKYS",
        "proteome": null,
        "gene": "rps14",
        "go_terms": [
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003735",
                "name": "structural constituent of ribosome",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006412",
                "name": "translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0015935",
                "name": "small ribosomal subunit",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0008270",
                "name": "zinc ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005840",
                "name": "ribosome",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "73a55bc605f5d10b7a90e4800b26c31c42c6bac8",
        "counters": {
            "domain_architectures": 49157,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "hamap": 1,
                "ncbifam": 1,
                "panther": 1,
                "pfam": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 49157
        }
    }
}