General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q8NFU1",
        "id": "BEST2_HUMAN",
        "source_organism": {
            "taxId": "9606",
            "scientificName": "Homo sapiens",
            "fullName": "Homo sapiens (Human)"
        },
        "name": "Bestrophin-2a",
        "description": [
            "Ligand-gated anion channel that allows the movement of anions across cell membranes when activated by calcium (Ca2+) (PubMed:11904445, PubMed:18400985, PubMed:32251414, PubMed:35789156, PubMed:36289327). Transports a large specter of anions, namely mediates the movement of chloride, L-glutamate and iodide (PubMed:11904445, PubMed:18400985, PubMed:32251414, PubMed:35789156, PubMed:36289327). Calcium-binding triggers the dilation of the aperture, but calcium-dependent gating is only effective when the size of the passing anion is bigger than the closed aperture (By similarity). Mediates the calcium-activated hydrogencarbonate movement and participates in colonic hydrogencarbonate secretion concomitant with mucin secretion (By similarity). In non-pigmented epithelium (NPE), mediates the efflux of intracellular L-glutamate; binding of intracellular L-glutamate activates and open both the neck and the aperture of the channel, leading to L-glutamate exit promoting chloride influx movement from the extracellular side in trans (PubMed:36289327). Also exhibits a directional permeability for intracellular glutamine, in a similar manner as for L-glutamate (PubMed:36289327)"
        ],
        "length": 509,
        "sequence": "MTVTYTARVANARFGGFSQLLLLWRGSIYKLLWRELLCFLGFYMALSAAYRFVLTEGQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVNRWWSQYLCMPLPDALMCVVAGTVHGRDDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRFPTIDHVVEAGFMTREERKKFENLNSSYNKYWVPCVWFSNLAAQARREGRIRDNSALKLLLEELNVFRGKCGMLFHYDWISVPLVYTQVVTIALYSYFLACLIGRQFLDPAQGYKDHDLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAVDEMYDDLAVLEKDLYWDAAEARAPYTAATVFQLRQPSFQGSTFDITLAKEDMQFQRLDGLDGPMGEAPGDFLQRLLPAGAGMVAGGPLGRRLSFLLRKNSCVSEASTGASCSCAVVPEGAAPECSCGDPLLDPGLPEPEAPPPAGPEPLTLIPGPVEPFSIVTMPGPRGPAPPWLPSPIGEEEENLA",
        "proteome": "UP000005640",
        "gene": "BEST2",
        "go_terms": [
            {
                "identifier": "GO:0005254",
                "name": "chloride channel activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "db487642f0c97325aedfc0ede79cac13e1137518",
        "counters": {
            "domain_architectures": 8424,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 10,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 8424
        }
    }
}