GET /api/protein/UniProt/Q8DG81/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q8DG81",
        "id": "CBIM_THEVB",
        "source_organism": {
            "taxId": "197221",
            "scientificName": "Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)",
            "fullName": "Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)"
        },
        "name": "Cobalt transport protein CbiM",
        "description": [
            "Part of the energy-coupling factor (ECF) transporter complex CbiMNOQ involved in cobalt import"
        ],
        "length": 257,
        "sequence": "MVKPTQAKRYASLGAIALLTTSLVVASPNPALAMHISEGFLPLGWAVGWWLAFLPFLAWGLWSLQQQIKQHSESVLLVALAGAYAFVVSSLKIPSVTGSCSHPIGIALGAILFRPPLMAVLGTLVLLFQSLLIAHGGLTTLGANAFSMAVVGPWLAWLTYCGVSRLRVKPAIALFAASFISNVGTYTLTSLQLALAFPDSVGGLATSFAKFGTLFAVTQIPLAISEGLLTVLVWNWLTTYCVAELQALRLLPQEELP",
        "proteome": "UP000000440",
        "gene": "cbiM",
        "go_terms": [
            {
                "identifier": "GO:0006824",
                "name": "cobalt ion transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009236",
                "name": "cobalamin biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0043190",
                "name": "ATP-binding cassette (ABC) transporter complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0000041",
                "name": "transition metal ion transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0529123993b892b4c99c40ce24cdb0564fe693f7",
        "counters": {
            "domain_architectures": 8980,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "panther": 1,
                "ncbifam": 2,
                "hamap": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 8980
        }
    }
}