GET /api/protein/UniProt/Q8CQE3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q8CQE3",
        "id": "Y165_STAES",
        "source_organism": {
            "taxId": "176280",
            "scientificName": "Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)",
            "fullName": "Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)"
        },
        "name": "Uncharacterized response regulatory protein SE_0165",
        "description": [
            "Probable member of the two-component regulatory system SE_0166/SE_0165"
        ],
        "length": 251,
        "sequence": "MFKVVICDDERIIRQGLKQMIPWKEYHFTTIYTATDGVEALSLIRQHQPELVITDIRMPRKNGVDLLDDIKDLDCQVIILSSYDDFEYMKAGIQHHVLDYLLKPVDHTQLEHILDILVQRLLERPHSTNDDAAYYTAFQPLLKIDYDDYYVNQILSQIKQHYHKKVTVLDLINPIVVSESYAMRTFKEHVGITIVDYLNRYRILKSLHLLDQHYKHYEIAEKVGFSEYKMFCYHFKKYLHMSPSDYNKLSK",
        "proteome": null,
        "gene": "SE_0165",
        "go_terms": [
            {
                "identifier": "GO:0000160",
                "name": "phosphorelay signal transduction system",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003700",
                "name": "DNA-binding transcription factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0043565",
                "name": "sequence-specific DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "325fead2059cae88badcae2f43b34da8fb2986b9",
        "counters": {
            "domain_architectures": 23395,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "smart": 2,
                "profile": 2,
                "pfam": 2,
                "cdd": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 23395
        }
    }
}