GET /api/protein/UniProt/Q8CBC7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q8CBC7",
        "id": "TRM7_MOUSE",
        "source_organism": {
            "taxId": "10090",
            "scientificName": "Mus musculus",
            "fullName": "Mus musculus (Mouse)"
        },
        "name": "tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase",
        "description": [
            "Methylates the 2'-O-ribose of nucleotides at positions 32 and 34 of the tRNA anticodon loop of substrate tRNAs (PubMed:33771871). Requisite for faithful cytoplasmic translation (PubMed:33771871). Requires THADA for methylation of the cytidine at position 32 of the anticodon loop of substrate tRNAs (By similarity). Requires WDR6 for methylation of the nucleotide at position 34 of the anticodon loop of substrate tRNAs (By similarity). Promotes translation efficiency of the UUU codon (PubMed:33771871). Plays a role in neurogenesis (PubMed:33771871, PubMed:36101392). Required for expression of genes involved in neurogenesis and mitochondrial translation and energy generation (PubMed:30557699, PubMed:33771871, PubMed:36101392). Requisite for RNA-mediated gene silencing (By similarity). May modify position 32 in tRNA(Arg(ACG)), tRNA(Gln(CUG)), tRNA(Leu(UAA)), tRNA(Leu(UAG)), tRNA(Leu(AAG)), tRNA(Leu(CAG)), tRNA(Phe(GAA)), tRNA(Trp(CCA)) and tRNA(Val(AAC)), and position 34 in tRNA(Phe(GAA)), tRNA(Leu(CAA)), tRNA(Leu(UAA)), tRNA(Sec(UCA)), and tRNA(Trp(CCA)) (PubMed:33771871)"
        ],
        "length": 324,
        "sequence": "MGRTSKDKRDVYYRLAKENGWRARSAFKLLQLDEEFQLFKGVKRAVDLCAAPGSWSQVLSQKVGGQGSGQVVAVDLQAMAPLPGVIQIQGDITQLSTAKEIIQHFEGCPADLVVCDGAPDVTGLHDVDEYMQAQLLLAALNIATHVLKLGGCFVAKIFRGRDVTLLYSQLRIFFSSVLCAKPKSSRNSSIEAFAVCQGYDPPEGFIPDLTRPLLNHSYDTDFNQLDGPTRVIVPFVACGDLSAYDSDRTYSLDLDGGSEYKYTPPTQPPIAPPYQEACRLKKNGQLAKELLPQECSINSVDKLPQPLAIHTLLDPKVEDNEIHC",
        "proteome": "UP000000589",
        "gene": "Ftsj1",
        "go_terms": [
            {
                "identifier": "GO:0008175",
                "name": "tRNA methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008033",
                "name": "tRNA processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008168",
                "name": "methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0001510",
                "name": "RNA methylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0032259",
                "name": "methylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "71a5d42e748b06cd2d42035318a449fe592a7c1a",
        "counters": {
            "domain_architectures": 26600,
            "entries": 11,
            "isoforms": 3,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "hamap": 2,
                "panther": 1,
                "pfam": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 26600
        }
    }
}