General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q8B118",
        "id": "Q8B118_WWAVU",
        "source_organism": {
            "taxId": "3052331",
            "scientificName": "Whitewater Arroyo mammarenavirus (isolate Rat/United States/AV 9310135/1995)",
            "fullName": "Whitewater Arroyo mammarenavirus (isolate Rat/United States/AV 9310135/1995) (WWAV)"
        },
        "name": "Pre-glycoprotein polyprotein GP complex",
        "description": [
            "[Glycoprotein G1]: Forms the virion spikes together with glycoprotein G2. The glycoprotein spike trimers are connected to the underlying matrix. Interacts with the host receptor leading to virus endocytosis",
            "[Glycoprotein G2]: Forms the virion spikes together with glycoprotein G1. The glycoprotein spike trimers are connected to the underlying matrix. Class I viral fusion protein that directs fusion of viral and host endosomal membranes, leading to delivery of the nucleocapsid into the cytoplasm. Membrane fusion is mediated by irreversible conformational changes induced by acidification",
            "[Stable signal peptide]: Functions as a cleaved signal peptide that is retained as the third component of the GP complex (GP-C). Helps to stabilize the spike complex in its native conformation. The SSP is required for efficient glycoprotein expression, post-translational maturation cleavage of G1 and G2, glycoprotein transport to the cell surface plasma membrane, formation of infectious virus particles, and acid pH-dependent glycoprotein-mediated cell fusion"
        ],
        "length": 480,
        "sequence": "MGQLISFFGEIPSIIHEALNIALIAVSIISILKGVINIWGSGLLQFIVFLLLAGRSCSYKIGHHVELQHIILNASYITPYVPMPCMINDTHFLLRGPFEASWAIKLEITDVTTLVVDTDNVANPTNISKCFANNQDERLLGFTMEWFLSGLEHDHHFTPQIICGNVSKGEVNAQVNITMEDHCSQVFLKMRRIFGVFKNPCTSHGKQNVLISVSNWTNQCSGNHLSSMHLIVQNAYKQMIKSRTLKSFFAWSLSDATGTDMPGGYCLEKWMLISSELKCFGNTAIAKCNLDHSSEFCDMLKLFEFNRNAIKTLQNDSKHQLDMIITAVNSLISDNTLMKNRLKELINIPYCNYTKFWYVNHTGFNVHSLPRCWLTKNGSYLNVSDFRNQWLLESDHLISEILSREYEARQGKTPLGLVDVCFWSTLFYVSSIFLHLLRIPTHRHIIGEGCPKPHRLSSDSVCACGLFKQKGRPLRWARKV",
        "proteome": null,
        "gene": "GPC",
        "go_terms": [
            {
                "identifier": "GO:0019031",
                "name": "viral envelope",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "6114ce4f51c932e32e40e6a41adb3d59a476f678",
        "counters": {
            "domain_architectures": 68,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "pfam": 1,
                "hamap": 1,
                "pirsf": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 68
        }
    }
}