General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q8AVM7",
        "id": "5MP2_XENLA",
        "source_organism": {
            "taxId": "8355",
            "scientificName": "Xenopus laevis",
            "fullName": "Xenopus laevis (African clawed frog)"
        },
        "name": "eIF5-mimic protein 2",
        "description": [
            "Translation initiation regulator which may repress repeat-associated non-AUG (RAN) initiated translation probably by acting as a competitive inhibitor of eukaryotic translation initiation factor 5 (EIF5) function (By similarity). Enhances histone H4 gene transcription but does not seem to bind DNA directly (By similarity)"
        ],
        "length": 419,
        "sequence": "MNNQKQQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLNETGNDLEAVAKFLDASGAKLDYRRYAETLFDILVAGGMLAPGGTLADEVIRTDVCVFSAQEDLETMQAFAQVFNKLIRRYKYLEKGFEEEVKKLLLFLKGFSESERNKLAMLTGILLANGNLSASILNSLYNENLVKEGVSAAFAVKLFKSWINEKDINAVAGSLRKVNMDNRLMELFPANKQTVEHFTKYYTDAGLKELAEYVRNQQTIGARKEIHKELQEMISRGEAHKEISVYVKDEMKKNNISEQTVIGILWSSIMSCVEWNKKEELVTEQAIKHLKQYSPLLAAFTTQGQSELTLLLKIQEYCYDNIHFMKSFQKIVVLFYKAEVLSEEPILKWYKDAHVAKGKSVFLEQMKKFVEWLKNAEEESESETEEGD",
        "proteome": "UP000186698",
        "gene": "bzw1",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "178040f393a077c1232aeaee540ab58b8e15b69a",
        "counters": {
            "domain_architectures": 3978,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "cdd": 1,
                "cathgene3d": 1,
                "profile": 1,
                "ssf": 1,
                "smart": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3978
        }
    }
}