GET /api/protein/UniProt/Q89PQ7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q89PQ7",
        "id": "Q89PQ7_BRADU",
        "source_organism": {
            "taxId": "224911",
            "scientificName": "Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)",
            "fullName": "Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)"
        },
        "name": "ABC transporter domain-containing protein",
        "description": [
            "Involved in beta-(1-->2)glucan export. Transmembrane domains (TMD) form a pore in the inner membrane and the ATP-binding domain (NBD) is responsible for energy generation"
        ],
        "length": 237,
        "sequence": "MSEMFSMTDVTVCYDNVEAVRNVSLSVEEGQIVTVIGPNGAGKTTLLMAAIGLLASRGRLVFQGNDIGRMSVEDRVERRLCLVPEKRELFSDMSVADNLLLGSYSLRDRSGVQKTLDEVYDRFPRLKERQRQAAGTLSGGERQMLALGRALMAKPKLLMLDEPSLGLAPLIVREIFRTIASLRDLGVSILLVEQNARAALETADYGYVLETGEVVQSGPAKDLIHDPRLITAYLGGH",
        "proteome": "UP000002526",
        "gene": "bll3423",
        "go_terms": [
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016887",
                "name": "ATP hydrolysis activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "48e3bc51d04b3fd112e2624fb984e1b2e9042b86",
        "counters": {
            "domain_architectures": 1059062,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "cdd": 1,
                "pfam": 1,
                "smart": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1059062
        }
    }
}