GET /api/protein/UniProt/Q89PQ7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q89PQ7",
"id": "Q89PQ7_BRADU",
"source_organism": {
"taxId": "224911",
"scientificName": "Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)",
"fullName": "Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)"
},
"name": "ABC transporter domain-containing protein",
"description": [
"Involved in beta-(1-->2)glucan export. Transmembrane domains (TMD) form a pore in the inner membrane and the ATP-binding domain (NBD) is responsible for energy generation"
],
"length": 237,
"sequence": "MSEMFSMTDVTVCYDNVEAVRNVSLSVEEGQIVTVIGPNGAGKTTLLMAAIGLLASRGRLVFQGNDIGRMSVEDRVERRLCLVPEKRELFSDMSVADNLLLGSYSLRDRSGVQKTLDEVYDRFPRLKERQRQAAGTLSGGERQMLALGRALMAKPKLLMLDEPSLGLAPLIVREIFRTIASLRDLGVSILLVEQNARAALETADYGYVLETGEVVQSGPAKDLIHDPRLITAYLGGH",
"proteome": "UP000002526",
"gene": "bll3423",
"go_terms": [
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016887",
"name": "ATP hydrolysis activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "48e3bc51d04b3fd112e2624fb984e1b2e9042b86",
"counters": {
"domain_architectures": 1059062,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"profile": 1,
"cdd": 1,
"pfam": 1,
"smart": 1,
"panther": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1059062
}
}
}