General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q89A45",
        "id": "MUTY_BUCBP",
        "source_organism": {
            "taxId": "224915",
            "scientificName": "Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)",
            "fullName": "Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)"
        },
        "name": "Adenine DNA glycosylase",
        "description": [
            "Adenine glycosylase active on G-A mispairs. MutY also corrects error-prone DNA synthesis past GO lesions which are due to the oxidatively damaged form of guanine: 7,8-dihydro-8-oxoguanine (8-oxo-dGTP)"
        ],
        "length": 351,
        "sequence": "MTTLVFYQTILNWYHHFGRKTLPWQIKKNPYKTWISEIMLQQTQVKTVIPYYCKFIKRFPNIDTLSDSPLDSILNLWSGLGYYTRARNIYKTAKILKQKFNGIFPNSYAEIIKLPGIGKSTAGAILSFGFNLYSCILDGNIKRVLIRYYSININNKYIEKLLWKTIESITPIYHTNKFNQALIDIGALICLKSNPKCNICPLKSTCKSYLNNKLFQINCKKNKKHIIPKTKYWFLILQYKNYIFLEKRQNLGIWKKLFCFPQFIRQNDILSWIQKNNTKIKKINILNEFKHKLSHLTLYINPIWIIINKISIFSNNNKTIWYNLNNPQCIGLPTPVTKIITKIKKFNTHHE",
        "proteome": "UP000000601",
        "gene": "mutY",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006281",
                "name": "DNA repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006284",
                "name": "base-excision repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051539",
                "name": "4 iron, 4 sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019104",
                "name": "DNA N-glycosylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016798",
                "name": "hydrolase activity, acting on glycosyl bonds",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8ff9f628ea268ecae0b9bd2b22ca1fd1a216b8d9",
        "counters": {
            "domain_architectures": 10445,
            "entries": 27,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cathgene3d": 3,
                "cdd": 2,
                "pfam": 3,
                "smart": 2,
                "ncbifam": 1,
                "panther": 1,
                "prosite": 2,
                "interpro": 11
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 10445
        }
    }
}