GET /api/protein/UniProt/Q87EB9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q87EB9",
        "id": "CARA_XYLFT",
        "source_organism": {
            "taxId": "183190",
            "scientificName": "Xylella fastidiosa (strain Temecula1 / ATCC 700964)",
            "fullName": "Xylella fastidiosa (strain Temecula1 / ATCC 700964)"
        },
        "name": "Carbamoyl phosphate synthase small chain",
        "description": [
            "Small subunit of the glutamine-dependent carbamoyl phosphate synthetase (CPSase). CPSase catalyzes the formation of carbamoyl phosphate from the ammonia moiety of glutamine, carbonate, and phosphate donated by ATP, constituting the first step of 2 biosynthetic pathways, one leading to arginine and/or urea and the other to pyrimidine nucleotides. The small subunit (glutamine amidotransferase) binds and cleaves glutamine to supply the large subunit with the substrate ammonia"
        ],
        "length": 374,
        "sequence": "MTEHAILVLEDGTVFEGDAVGANGLSVGEVVFNTALTGYQEILTDPSYAYQLVTLTYPHIGNTGCTDQDDEANKVWAAGLIVRDVPRRPSNWRSQISLSDWLAARGVVAIAGIDTRKLTRILREKGAQHGALMAGEIDVGKAQDAAHQFAGIKGMDLAKVVSTKQGYSWYEGQLDLDRNECKRAAPQYKVVAYDYGVKLNILRMLAERGCDLTVVPAQTPADEVLALCPDGVFLSNGPGDPEPCDYAVAAIKTFIMRRVPIFGICLGHQLLAQAVGARVVKMSHGHHGANHPVQDLRSGRVMITSQNHGFAVDEATLPNNVRVTHRSLFDGTNQGIELLDVPAFSFQGHPEASPGPHDVDVLFDRFITMMAAQS",
        "proteome": "UP000002516",
        "gene": "carA",
        "go_terms": [
            {
                "identifier": "GO:0004088",
                "name": "carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006207",
                "name": "'de novo' pyrimidine nucleobase biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006541",
                "name": "glutamine metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ca8d55c21f73d160cbeb47ce92e2ac93ab15d9c4",
        "counters": {
            "domain_architectures": 31871,
            "entries": 23,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "smart": 1,
                "ssf": 2,
                "pfam": 2,
                "profile": 1,
                "cdd": 1,
                "hamap": 1,
                "ncbifam": 2,
                "panther": 1,
                "prints": 3,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 31871
        }
    }
}