General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q865S0",
        "id": "RCAS1_CANLF",
        "source_organism": {
            "taxId": "9615",
            "scientificName": "Canis lupus familiaris",
            "fullName": "Canis lupus familiaris (Dog)"
        },
        "name": "Receptor-binding cancer antigen expressed on SiSo cells",
        "description": [
            "May participate in suppression of cell proliferation and induces apoptotic cell death through activation of interleukin-1-beta converting enzyme (ICE)-like proteases"
        ],
        "length": 213,
        "sequence": "MAITQFRLFKVCTCLATVFSFLKRLICRSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNALEQLEPDYFKDMTPTIRKTQKIIIKKREPLNFGIPDGSTGFSSRLAATQDMPFIHQSPELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKIADREKRAAEQQRKRMEKEAQRLMRKEQNKIGVKLS",
        "proteome": "UP000805418",
        "gene": "EBAG9",
        "go_terms": null,
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b1be0c67d39fa62445ceae24cf27755d6757915f",
        "counters": {
            "domain_architectures": 1039,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "pirsf": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1039
        }
    }
}