HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q83DN2",
"id": "DAPE_COXBU",
"source_organism": {
"taxId": "227377",
"scientificName": "Coxiella burnetii (strain RSA 493 / Nine Mile phase I)",
"fullName": "Coxiella burnetii (strain RSA 493 / Nine Mile phase I)"
},
"name": "Succinyl-diaminopimelate desuccinylase",
"description": [
"Catalyzes the hydrolysis of N-succinyl-L,L-diaminopimelic acid (SDAP), forming succinate and LL-2,6-diaminopimelate (DAP), an intermediate involved in the bacterial biosynthesis of lysine and meso-diaminopimelic acid, an essential component of bacterial cell walls"
],
"length": 374,
"sequence": "MSETLNLLKQLIERPSITPNDAGCQTILIDRLKSVGFQCEHLPFGEVHNFWAWHGHQSPFIIFAGHTDVVPPGDETQWHSPPFTPTEKNGYIYGRGAADMKSGLAAMVVAAENFVKQNPDHNGTIGFIVTSDEEGPAENGTQKVVDYLQQKNIKLDYCIVGEASSNEKLGDAIKIGRRGSMHGELTIIGKQGHIAYPHLADNPIHRSFQAFEALAKTKWDEGNEHFTPTSFQFYNVEAGAGAANVIPATLKAKFNFRFAPIHTTQQLQQKVERILNYYQLNYDIQWNVSSQPFFSGNGRLATFVRQAIQEICHLNTEPNTYGGTSDGRFIATTGCEVIELGPVNKTAHHVNENICIADLEKLTDIYFRTLQLLT",
"proteome": "UP000002671",
"gene": "dapE",
"go_terms": [
{
"identifier": "GO:0009014",
"name": "succinyl-diaminopimelate desuccinylase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009089",
"name": "L-lysine biosynthetic process via diaminopimelate",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016787",
"name": "hydrolase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "2fe7134b29da9e8c9accfe48fc79c38e73cb2340",
"counters": {
"domain_architectures": 196902,
"entries": 18,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"cdd": 1,
"pfam": 2,
"ncbifam": 2,
"hamap": 1,
"panther": 1,
"prosite": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 196902
}
}
}