General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q809U8",
        "id": "Q809U8_IH5N1",
        "source_organism": {
            "taxId": "196432",
            "scientificName": "Influenza A virus (A/Pigeon/Hong Kong/SF215/01 (H5N1))",
            "fullName": "Influenza A virus (A/Pigeon/Hong Kong/SF215/01 (H5N1))"
        },
        "name": "Neuraminidase",
        "description": [
            "Catalyzes the removal of terminal sialic acid residues from viral and cellular glycoconjugates"
        ],
        "length": 352,
        "sequence": "MNPNQKIITIGSICMVIGIVSLMLQIGNIISIWVSHSIQTGNQHQAEPIGNTNFLTEKAVASVTLAGNSSLCPISGWAVHSKDNGIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVNDRSPHRTLMSCPVGEAPSPYNSRFESVAWSASACHDGTSWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQASYKIFKMEKGKVVKSVELDAPNYHYEECSCYPDAGEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSPNGAYGVKGFSFKYGNGVWIGRTKSTNSRSGFE",
        "proteome": null,
        "gene": "NA",
        "go_terms": [
            {
                "identifier": "GO:0004308",
                "name": "exo-alpha-sialidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005975",
                "name": "carbohydrate metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0033644",
                "name": "host cell membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0055036",
                "name": "virion membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "3df12d7e120e99fb24ba41a68325d8957d880637",
        "counters": {
            "domain_architectures": 101461,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 101461
        }
    }
}