GET /api/protein/UniProt/Q805B2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q805B2",
"id": "FGF8B_DANRE",
"source_organism": {
"taxId": "7955",
"scientificName": "Danio rerio",
"fullName": "Danio rerio (Zebrafish)"
},
"name": "Fibroblast growth factor 8b",
"description": [
"May act as signaling molecule during development of the midbrain-hindbrain boundary (MHB) organizer, and be involved in patterning of the nervous system"
],
"length": 212,
"sequence": "MRLKSSRLGYLFLQFMTLCFYTQMTMQSISMPNFKHHVTEQSRLSDRMSRRLTRTYQLYSRTSGKHVQVLGNKRVNANAEDGDIHAKLVVETDTFGSRVRIRGAKTGYYICMNKKGKLIGRRKGRGKDCIFTEIVLENNYTALQNAKYKGWYMAFTRKGRPRKAMQTRQHQREAHFMKRLPRGHLLTEQKPFDLIPYPLNKRTKHHQRASVN",
"proteome": "UP000000437",
"gene": "fgf8b",
"go_terms": [
{
"identifier": "GO:0008083",
"name": "growth factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 2,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5171d0377b6deb31d3e4658b327f83b114bedf70",
"counters": {
"domain_architectures": 24103,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"ssf": 1,
"smart": 1,
"pfam": 1,
"panther": 1,
"prosite": 1,
"prints": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 24103
}
}
}