GET /api/protein/UniProt/Q7ZXS5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q7ZXS5",
        "id": "ERD22_XENLA",
        "source_organism": {
            "taxId": "8355",
            "scientificName": "Xenopus laevis",
            "fullName": "Xenopus laevis (African clawed frog)"
        },
        "name": "ER lumen protein-retaining receptor 2",
        "description": [
            "Receptor for the C-terminal sequence motif K-D-E-L that is present on endoplasmic reticulum resident proteins and that mediates their recycling from the Golgi back to the endoplasmic reticulum (By similarity). Binding is pH dependent, and is optimal at pH 5-5.4 (By similarity)"
        ],
        "length": 212,
        "sequence": "MNVFRLSGDLCHLAAIIILLLKIWNSRSCAGISGKSQLLFAMVFTTRYLDLFTSFISLYNTSMKVIYMGCAYATVYLIYMKFKATYDGNHDTFRVEFLVVPVGGLSVLVNHDFSPLEILWTFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRALYLFNWIWRFSFEGFFDLIAIVAGVVQTILYCDFFYLYVTKVLKGKKLSLPA",
        "proteome": "UP000186698",
        "gene": "kdelr2",
        "go_terms": [
            {
                "identifier": "GO:0046923",
                "name": "ER retention sequence binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006621",
                "name": "protein retention in ER lumen",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "96212a2cbeb9c26e7b5963c2ac7fa01e05b57673",
        "counters": {
            "domain_architectures": 11012,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 11012
        }
    }
}