General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q7ZWS2",
        "id": "5N3BA_XENLA",
        "source_organism": {
            "taxId": "8355",
            "scientificName": "Xenopus laevis",
            "fullName": "Xenopus laevis (African clawed frog)"
        },
        "name": "7-methylguanosine phosphate-specific 5'-nucleotidase A",
        "description": [
            "Specifically hydrolyzes 7-methylguanosine monophosphate (m(7)GMP) to 7-methylguanosine and inorganic phosphate. The specific activity for m(7)GMP may protect cells against undesired salvage of m(7)GMP and its incorporation into nucleic acids. Also has weak activity for CMP. UMP and purine nucleotides are poor substrates (By similarity)"
        ],
        "length": 290,
        "sequence": "MRLPVLGKDTVRMRDPEGLQDKITRIQRGGQEKLQIISDFDMTLSRFSRNGERCPTCYNIIDNSNIISDEGRKKLKCLFDIYYPLEIDPKKSIEEKYPLMVEWWSKAHDLFYEQRIQKDRLAQVVKESQATLRDGYDLFFNSLYQREIPLFIFSAGIGDVLEEIIRQAGVFHPNTKVVSNYMDFDDNGILTGFKGDLIHTYNKNSSVLKDTEYFKEISHRTNILLLGDTLGDLTMADGVSTVENIIKIGFLNDKVEELTEQFLQSYDIVLLRDETLDVVNGILQFVTAKN",
        "proteome": "UP000186698",
        "gene": "Nt5c3b-a",
        "go_terms": [
            {
                "identifier": "GO:0000287",
                "name": "magnesium ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008253",
                "name": "5'-nucleotidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3bf838631819b4cc9ae65b1def11ca3e416d0fd5",
        "counters": {
            "domain_architectures": 4692,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 2,
                "cdd": 1,
                "panther": 1,
                "sfld": 2,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4692
        }
    }
}