General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q7Z893",
        "id": "PYRD_SACMI",
        "source_organism": {
            "taxId": "114525",
            "scientificName": "Saccharomyces mikatae",
            "fullName": "Saccharomyces mikatae (Yeast)"
        },
        "name": "Dihydroorotate dehydrogenase (fumarate)",
        "description": [
            "Catalyzes the conversion of dihydroorotate to orotate with fumarate as the electron acceptor"
        ],
        "length": 314,
        "sequence": "MTASLTTKFLNNTYENPFMNASGVHCMTTEELDELADSKAGAFITKSATTLEREGNPKPRYISVPLGSINSMGLPNEGIDYYLSYVLNRQKKYPDAPAIFFSVAGMSIDENLNLLKKIQDSEFNGITELNLSCPNVPGKPQVAYDFELTKETLEKVFVFFKKPLGIKLPPYFDFAHFDIIAKILNEFPLAYVNSINSIGNGLFIDVEKESVVVKPKNGFGGIGGEYVKPTALANVRAFYTRLRPDIKVIGTGGIKSGKDAFEHLLCGASMLQIGTELQKEGVKIFERIEKELKDIMEAKGYTSIDQFRGKLNSL",
        "proteome": null,
        "gene": "URA1",
        "go_terms": [
            {
                "identifier": "GO:0016627",
                "name": "oxidoreductase activity, acting on the CH-CH group of donors",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0004152",
                "name": "dihydroorotate dehydrogenase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006221",
                "name": "pyrimidine nucleotide biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006222",
                "name": "UMP biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006207",
                "name": "'de novo' pyrimidine nucleobase biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "386746119d361a60cfbbc9964fada353b1100670",
        "counters": {
            "domain_architectures": 37617,
            "entries": 19,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "cathgene3d": 2,
                "pirsf": 1,
                "ncbifam": 1,
                "panther": 1,
                "hamap": 1,
                "prosite": 2,
                "interpro": 8
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 37617
        }
    }
}