HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q7W781",
"id": "Q7W781_BORPA",
"source_organism": {
"taxId": "257311",
"scientificName": "Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)",
"fullName": "Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)"
},
"name": "Inorganic pyrophosphatase",
"description": [
"Catalyzes the hydrolysis of inorganic pyrophosphate (PPi) forming two phosphate ions"
],
"length": 178,
"sequence": "MSLDRVAPGKKLPDDFNVIIEIPMNADPVKYEVDKESGAIFVDRFMLTAMHYPCNYGYIPQTLSEDGDPADVLVLTPFPIQIGAVVRCRAIGVLEMDDESGGDAKLLAVPIEKLYPPYRNIKSYEDLPAEDVSRIQHFFEHYKDLEKGKWVKVKGWKGVDAAHEEIVRSAERYAKGQA",
"proteome": null,
"gene": "ppa",
"go_terms": [
{
"identifier": "GO:0000287",
"name": "magnesium ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004427",
"name": "inorganic diphosphate phosphatase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006796",
"name": "phosphate-containing compound metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c08c0bcb16ac56d8d4f18c3a9ff5787af4a99cc5",
"counters": {
"domain_architectures": 31541,
"entries": 9,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"ncbifam": 1,
"panther": 1,
"hamap": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 31541
}
}
}