General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q7VYI1",
        "id": "LEUD1_BORPE",
        "source_organism": {
            "taxId": "257313",
            "scientificName": "Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)",
            "fullName": "Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)"
        },
        "name": "3-isopropylmalate dehydratase small subunit 1",
        "description": [
            "Catalyzes the isomerization between 2-isopropylmalate and 3-isopropylmalate, via the formation of 2-isopropylmaleate"
        ],
        "length": 202,
        "sequence": "MQAFIRAHGIILPMNQDHVDTDAIIPQRWLVTVERDGLADGFMGAWRYDEHGQPRPECVLNQPAYQGAAIVLARENYGCGSSREHAVWAHQGYGIRAIVAASYGPIFHENCLKNGLLPVTLPAADVATLMAQALADPGCACEVDLVSQRVIGPDGRAYPFEIDAGRRQLLLEGVDDIDLALARAADIAAFQRRQQQDQPWLA",
        "proteome": "UP000002676",
        "gene": "leuD1",
        "go_terms": [
            {
                "identifier": "GO:0003861",
                "name": "3-isopropylmalate dehydratase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009098",
                "name": "L-leucine biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009316",
                "name": "3-isopropylmalate dehydratase complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "49a7ddba3b9a812599e0f28bdd062c08864af900",
        "counters": {
            "domain_architectures": 4808,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "ncbifam": 2,
                "hamap": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4808
        }
    }
}