GET /api/protein/UniProt/Q7VR03/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q7VR03",
        "id": "Q7VR03_BLOFL",
        "source_organism": {
            "taxId": "203907",
            "scientificName": "Blochmanniella floridana",
            "fullName": "Blochmanniella floridana"
        },
        "name": "Aminodeoxychorismate synthase component 2",
        "description": [
            "Part of a heterodimeric complex that catalyzes the two-step biosynthesis of 4-amino-4-deoxychorismate (ADC), a precursor of p-aminobenzoate (PABA) and tetrahydrofolate. In the first step, a glutamine amidotransferase (PabA) generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by aminodeoxychorismate synthase (PabB) to produce ADC. PabA converts glutamine into glutamate only in the presence of stoichiometric amounts of PabB"
        ],
        "length": 193,
        "sequence": "MVNVILLNNLDSFTYNLVDQLRSNNHQVSVYSSQLPISVIMEALININNPILILSPGPGIPKHSGCMMYLIKQLKGRIPIIGICLGYQAIIQLYGGHISQSTEIFHGRSSLIYHDQLGMFTDIPNPLLVARYHSLIGIDIPNNLKINAYYNTKTAMSVRNDHDRICGFQFHPESILTAHGTQLINQTIKWTQI",
        "proteome": "UP000002192",
        "gene": "trpG",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a79a81cdbd2eef5f5e295147e6f92925489d815d",
        "counters": {
            "domain_architectures": 82564,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "ncbifam": 1,
                "prints": 2,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 82564
        }
    }
}