General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q7SYH5",
        "id": "SC5A8_XENLA",
        "source_organism": {
            "taxId": "8355",
            "scientificName": "Xenopus laevis",
            "fullName": "Xenopus laevis (African clawed frog)"
        },
        "name": "Sodium-coupled monocarboxylate transporter 1",
        "description": [
            "Acts as an electrogenic sodium (Na(+)) and chloride (Cl-)-dependent sodium-coupled solute transporter, including transport of monocarboxylates (short-chain fatty acids including L-lactate, D-lactate, pyruvate, acetate, propionate, valerate and butyrate), mocarboxylate drugs (nicotinate, benzoate, salicylate and 5-aminosalicylate) and ketone bodies (beta-D-hydroxybutyrate, acetoacetate and alpha-ketoisocaproate), with a Na(+):substrate stoichiometry of between 4:1 and 2:1 (By similarity). Catalyzes passive carrier mediated diffusion of iodide. Mediates iodide transport from the thyrocyte into the colloid lumen through the apical membrane (By similarity). Mediates sodium-coupled electrogenic transport of pyroglutamate (5-oxo-L-proline) (By similarity). Can mediate the transport of chloride, bromide, iodide and nitrate ions when external concentration of sodium ions is reduced (By similarity)"
        ],
        "length": 622,
        "sequence": "MVTPGNIGSFTVWDYLVFALMLLISAVIGIYYAFAGGGQKTSKDFLMGGRSMTAVPVALSLTASFMSAVTVLGTPAEVYRFGAMFIIFAFSYTIVVIISSEVFLPVFYRLGITSTYEYLELRFNKFVRLLGTILFIIQTVLYTGIVIYAPALALNQVTGFDLWGAVVATGVVCTFYCTMGGLKAVVWTDVFQVGIMVAGFTSVIIRAVVVQGGIGPILNDSYYGDRLNFWDFDPNPLKRHTFWTIVVGGTFTWTGIYGVNQAQVQRYIACKTRFQAKMSLYVNLIGLWAILACAVLSGLAMYSIYKDCDPWTAKFVSAPDQLMPYLALDILRDYPGLPGLFVSCAYSGTLSTVSSSINALAAVTVEDLIKPYIRSLSEKKMSWISKGTSLLYGAICIGMAGIASLMGGLLQAALSIFGMVGGPLLGLFSLGILFPFVNSLGAVIGLLSGFAISLWVGIGSQIYAPSPSSSLPKPLSLEGCNFTSIESNWTSTVMPMMTTLIPETQVSSRPELADSWYSLSYLYFSTIGTIVAVLVGVIVSLLSGGLKQNVNREFLLTSEDFSYLNVLFSPCKEKGQEEKVEVLNWKARRTDNDMEQGTDNPAFNNMEMTSTEKGEKTNGITA",
        "proteome": "UP000186698",
        "gene": "slc5a8",
        "go_terms": [
            {
                "identifier": "GO:0022857",
                "name": "transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0055085",
                "name": "transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2b2a6841043927bd4b57fafc3151ff36fdcbb775",
        "counters": {
            "domain_architectures": 98886,
            "entries": 10,
            "isoforms": 2,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "profile": 1,
                "cathgene3d": 1,
                "panther": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 98886
        }
    }
}