General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q7ANN3",
        "id": "Q7ANN3_RHIME",
        "source_organism": {
            "taxId": "266834",
            "scientificName": "Rhizobium meliloti (strain 1021)",
            "fullName": "Rhizobium meliloti (strain 1021) (Ensifer meliloti)"
        },
        "name": "Cytochrome bo(3) ubiquinol oxidase subunit 3",
        "description": [
            "Cytochrome bo(3) ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron"
        ],
        "length": 210,
        "sequence": "MTEFHTERALDEGQAPAFYLTEEHHPEGSTMLGFWLYLMSDCLIFAVLFATHAVLGRNYAAGPSPADLFDLPLVAVNTSMLLFSSITYGFAMLAMERYEKKATLTWMAVTALFGIAFVGLEFYEFAHLLHEGAGPQRSAFLSSFFTLVGTHGLHVTAGIVWMFVLMAQVAKRGLIPENKRRLMCLSMFWHFLDVVWIGVFSFVYLMGVLG",
        "proteome": "UP000001976",
        "gene": "cyoC",
        "go_terms": [
            {
                "identifier": "GO:0009055",
                "name": "electron transfer activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0004129",
                "name": "cytochrome-c oxidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0022904",
                "name": "respiratory electron transport chain",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0019646",
                "name": "aerobic electron transport chain",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009486",
                "name": "cytochrome bo3 ubiquinol oxidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "663ba42a1d577dd726fd8458ee1fa2f51292c5b5",
        "counters": {
            "domain_architectures": 68158,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cdd": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "profile": 1,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 68158
        }
    }
}