GET /api/protein/UniProt/Q777L1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q777L1",
"id": "Q777L1_9GEMI",
"source_organism": {
"taxId": "220938",
"scientificName": "Tomato yellow leaf curl virus-[Almeria]",
"fullName": "Tomato yellow leaf curl virus-[Almeria]"
},
"name": "Protein V2",
"description": [
"Through its interaction with host SGS3, acts as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs"
],
"length": 116,
"sequence": "MWDPLLNEFPESVHGFRCMLAIKYLQSVEETYEPNTLGHDLIRDLISVVRARDYVEATRRYNHFHARLEGSPKAELRQPIQQPCCCPHCPRHKQATIMDVQAHVPKAQNIQNVSKP",
"proteome": "UP000201610",
"gene": "v2",
"go_terms": [
{
"identifier": "GO:0044003",
"name": "symbiont-mediated perturbation of host process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0060967",
"name": "negative regulation of gene silencing by regulatory ncRNA",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0030430",
"name": "host cell cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "5049c742507e160c725c1443e59dca4eb36f3c7e",
"counters": {
"domain_architectures": 2572,
"entries": 4,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2572
}
}
}