HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q738X7",
"id": "TYSY_BACC1",
"source_organism": {
"taxId": "222523",
"scientificName": "Bacillus cereus (strain ATCC 10987 / NRS 248)",
"fullName": "Bacillus cereus (strain ATCC 10987 / NRS 248)"
},
"name": "Thymidylate synthase",
"description": [
"Catalyzes the reductive methylation of 2'-deoxyuridine-5'-monophosphate (dUMP) to 2'-deoxythymidine-5'-monophosphate (dTMP) while utilizing 5,10-methylenetetrahydrofolate (mTHF) as the methyl donor and reductant in the reaction, yielding dihydrofolate (DHF) as a by-product. This enzymatic reaction provides an intracellular de novo source of dTMP, an essential precursor for DNA biosynthesis"
],
"length": 318,
"sequence": "MKHAENEYLNLCRHVMEHGTKKEDRTGTGTVSVFGYQMRFDLSKGFPLLTTKRVPFRLVASELLWFMKGDTNIRYLLQHNNNIWNEWAFKSWVESDEYTGPDMTDFGLRSQQDEEFKVQYDEQMELFKKNVLEDDDFSNKYGYLGDVYGKQWRAWKTTAGETLDQLKDVIEMIKKTPDSRRLIVSAWNPEDVPSMALPPCHTLFQFYVADGKLSCQLYQRSGDIFLGIPFNIASYSLLTHLIAHECGLEVGEFVHTIGDAHIYTNHFEQVEKQLAREPRPFPKLTLNPDVKSVFDFEMEDLTIEGYDPHPAIKAPVAV",
"proteome": null,
"gene": "thyA",
"go_terms": [
{
"identifier": "GO:0016741",
"name": "transferase activity, transferring one-carbon groups",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004799",
"name": "thymidylate synthase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006231",
"name": "dTMP biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6571d43d0db3476d3b47929b03c39208d2a83a8a",
"counters": {
"domain_architectures": 27171,
"entries": 15,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"cdd": 1,
"ncbifam": 2,
"panther": 1,
"hamap": 1,
"prosite": 1,
"prints": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 27171
}
}
}