GET /api/protein/UniProt/Q72J52/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q72J52",
"id": "Q72J52_THET2",
"source_organism": {
"taxId": "262724",
"scientificName": "Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)",
"fullName": "Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)"
},
"name": "Ribosome hibernation promoting factor",
"description": [
"Required for dimerization of active 70S ribosomes into 100S ribosomes in stationary phase; 100S ribosomes are translationally inactive and sometimes present during exponential growth"
],
"length": 186,
"sequence": "MNIYKLIGRNLEITDAIRDYVEKKLARLDRYQDGELMAKVVLSLAGSPHVEKKARAEIQVDLPGGLVRVEEEDADLYAAIDRAVDRLETQVKRFRERRYVGKRHSYQGPPPPEVRDLEALRKPEEEEGPRIVRVKRFEMKPMDPEEAAFQMEALGHSFFVFRNAKTDEINVIYRRKDGNYGLIEPA",
"proteome": null,
"gene": "hpf",
"go_terms": [
{
"identifier": "GO:0044238",
"name": "primary metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "10b787fd754c69bbea81ae0c717f606b2f3d6e03",
"counters": {
"domain_architectures": 13934,
"entries": 15,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"cdd": 1,
"pfam": 2,
"hamap": 1,
"ncbifam": 1,
"panther": 1,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 13934
}
}
}