HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q71LD9",
"id": "Q71LD9_CERMQ",
"source_organism": {
"taxId": "115872",
"scientificName": "Ceratozamia miqueliana",
"fullName": "Ceratozamia miqueliana (Miquel's horncone)"
},
"name": "ATP synthase subunit beta",
"description": [
"Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits"
],
"length": 484,
"sequence": "GVSTLVEKNVGRIVQIIGPVLDVAFPPGNMPNIFNSLIVKGQDTAGQEIHVTCEVQQLLGNNKVRAVAMSATDGLTRGMKVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDARTTSPIHRPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYVEMKESGVINEQDISRSKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPXTTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPWIVGEEHYETAQGVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLVETIRGFQMILSGELDGLPEQAFYLVGNIDEATAKAMNLKVES",
"proteome": null,
"gene": "atpB",
"go_terms": [
{
"identifier": "GO:0046034",
"name": "ATP metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:1902600",
"name": "proton transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0046933",
"name": "proton-transporting ATP synthase activity, rotational mechanism",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0015986",
"name": "proton motive force-driven ATP synthesis",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0045259",
"name": "proton-transporting ATP synthase complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "d079caac124722904c86efe2303dd63e1f2836bb",
"counters": {
"domain_architectures": 58128,
"entries": 27,
"isoforms": 0,
"proteomes": 0,
"sets": 5,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 3,
"ssf": 3,
"cdd": 3,
"pfam": 3,
"smart": 1,
"panther": 1,
"hamap": 1,
"ncbifam": 1,
"prosite": 1,
"interpro": 10
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 58128
}
}
}