GET /api/protein/UniProt/Q6Z3U5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q6Z3U5",
"id": "Q6Z3U5_ORYSJ",
"source_organism": {
"taxId": "39947",
"scientificName": "Oryza sativa subsp. japonica",
"fullName": "Oryza sativa subsp. japonica (Rice)"
},
"name": "BZIP domain-containing protein",
"description": [
"Transcription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication"
],
"length": 288,
"sequence": "MDMEKIAGADRDRAAETSSPPRPTKHRHSASFDGFAFGAGAGGPGPGLGKQQDGAGGVFSEVMEAKKAMSSEQLAELAAIDPKRAKRILANRQSAARSKERKARYITELERKVQTLQTEATTLSAQLTLFQRDTTGLSAENAELKIRLQAMEQQAQLRDALNDALKQEVERLKIATGEMAKSNDAYNTGMQQVPYSPSFFQLSDQHAVQHHAGVQQLPHQFQQPHPSVPSHQMLSHPNSLSDMMQQDSLGRLQGLDIGKGPVAVKNEAEVVVKSEGSSISAGESNSTF",
"proteome": null,
"gene": "OJ1205_F02.9",
"go_terms": [
{
"identifier": "GO:0003700",
"name": "DNA-binding transcription factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "890c9e17a3b426c841f953529dd29b6d471f4ea1",
"counters": {
"domain_architectures": 65153,
"entries": 10,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 1,
"profile": 1,
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"panther": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 65153
}
}
}