General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q6QPD2",
        "id": "Q6QPD2_9ADEN",
        "source_organism": {
            "taxId": "35266",
            "scientificName": "Simian adenovirus 23",
            "fullName": "Simian adenovirus 23"
        },
        "name": "Early E3 18.5 kDa glycoprotein",
        "description": [
            "Binds and retains class I heavy chains in the endoplasmic reticulum during the early period of virus infection, thereby impairing their transport to the cell surface. Also delays the expression of class I alleles that it cannot affect by direct retention. Binds transporters associated with antigen processing (TAP) and acts as a tapasin inhibitor, preventing class I/TAP association. In consequence, infected cells are masked for immune recognition by cytotoxic T-lymphocytes"
        ],
        "length": 176,
        "sequence": "MGKITLVSCGALVAVLLSIVGLGGAAVVKEKADPCLHFNPNKCQLSFQPDGNRCAVLIKCGWECENVRIEYNNKTRNNTLASVWQPGDPEWYTVSVPGADGSPRTVNNTFIFAHMCNTVMWMSKQYDMWPPTKENIVVFSIAYSLCTALITAIVCLSIHMLIAIRPRNNAEKEKQP",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0005537",
                "name": "D-mannose binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0052031",
                "name": "symbiont-mediated perturbation of host defense response",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "c09a65c6fe180942917741a571d8d65402d8e8f0",
        "counters": {
            "domain_architectures": 212,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 212
        }
    }
}