General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q6Q972",
        "id": "PCB_PRODI",
        "source_organism": {
            "taxId": "1216",
            "scientificName": "Prochloron didemni",
            "fullName": "Prochloron didemni"
        },
        "name": "Chlorophyll a/b light-harvesting protein Pcb",
        "description": [
            "The antenna complex functions as a light receptor, it captures and delivers excitation energy to photosystem II (PSII). The Prochlorales pcb genes are not related to higher plant LHCs"
        ],
        "length": 350,
        "sequence": "MGMQTYGNPDVEYGWWAGNSRLAGFSGKWLAAHVAQAALIVFWAGAICLFEVARYTADVPLGEQNLILIPHMASLGLGIGEGGQIVDTFPYFAVGVVHLVSSAVIGAGGLYHSLRGPAILKEGPARAPKFDFDWGDGKRLGFILGHHLILLGLGALFLVLWAVFFGIYDPVIGEVRTVTSPTLNPFTIFGYQTHFVETNTLEDLIGGHVYVAIIEISGGLWHIFCPPFKWAQRLIIYSGEGLLAYALGGLAIMGFTAAVYCAFNTLAYPVEFYGPPLDFRFSFAPYFIDTADLPSGQYTARAWLCNVHFFLAFFVLQGHLWHALRTLGFDFKRIPAALGSLSEDVVDAKA",
        "proteome": null,
        "gene": "pcb",
        "go_terms": [
            {
                "identifier": "GO:0016168",
                "name": "chlorophyll binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009767",
                "name": "photosynthetic electron transport chain",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0019684",
                "name": "photosynthesis, light reaction",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009521",
                "name": "photosystem",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "43a591bf7fa854337c3b9f2658c6bfb018907c99",
        "counters": {
            "domain_architectures": 34914,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "pfam": 1,
                "ncbifam": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 34914
        }
    }
}