HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q6PC30",
"id": "CSN5_DANRE",
"source_organism": {
"taxId": "7955",
"scientificName": "Danio rerio",
"fullName": "Danio rerio (Zebrafish)"
},
"name": "COP9 signalosome complex subunit 5",
"description": [
"Probable protease subunit of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of E3 ligase complexes, leading to modify the Ubl ligase activity. In the complex, it probably acts as the catalytic center that mediates the cleavage of nedd8 from cullins. It however has no metalloprotease activity by itself and requires the other subunits of the CSN complex"
],
"length": 334,
"sequence": "MAGSSIAMKTWELSNSMQEVQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKLSALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQAEAQLGRGSFMLGLDTHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQVNTSAN",
"proteome": "UP000000437",
"gene": "cops5",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008233",
"name": "peptidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008237",
"name": "metallopeptidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 2,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f19c2fb7e124ab75af2a7d27e44e869f70fab469",
"counters": {
"domain_architectures": 3818,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"pfam": 2,
"smart": 1,
"ssf": 1,
"profile": 1,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3818
}
}
}