General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q6NRQ7",
        "id": "SSU72_XENLA",
        "source_organism": {
            "taxId": "8355",
            "scientificName": "Xenopus laevis",
            "fullName": "Xenopus laevis (African clawed frog)"
        },
        "name": "RNA polymerase II subunit A C-terminal domain phosphatase SSU72",
        "description": [
            "May be involved in the C-terminal domain of RNA polymerase II dephosphorylation, RNA processing and termination"
        ],
        "length": 194,
        "sequence": "MPTAPLRVAVVCSSNQNRSMEAHNILSKRSFNVRSFGTGTHVKLPGPAPDKPNVYDFKTTYEQMYSDLLKKDKELYTQNGILHMLDRNRRIKPRPERFQNCKDYFDLVITCEERVYDQVVEELNSREQETCQPVHVINVDIQDNHEEATLGAFLICELCQCIQHTEDMENEIDELLQEFEDKSGRTFLHTICFY",
        "proteome": "UP000186698",
        "gene": "ssu72",
        "go_terms": [
            {
                "identifier": "GO:0004721",
                "name": "phosphoprotein phosphatase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006397",
                "name": "mRNA processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005634",
                "name": "nucleus",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6a02e70ccac1a6e2e8151473d344ffcc5b9fb6f5",
        "counters": {
            "domain_architectures": 4480,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4480
        }
    }
}