GET /api/protein/UniProt/Q6MGS5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q6MGS5",
        "id": "OBG_BDEBA",
        "source_organism": {
            "taxId": "264462",
            "scientificName": "Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)",
            "fullName": "Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)"
        },
        "name": "GTPase Obg",
        "description": [
            "An essential GTPase which binds GTP, GDP and possibly (p)ppGpp with moderate affinity, with high nucleotide exchange rates and a fairly low GTP hydrolysis rate. Plays a role in control of the cell cycle, stress response, ribosome biogenesis and in those bacteria that undergo differentiation, in morphogenesis control"
        ],
        "length": 343,
        "sequence": "MKFIDEVSISLASGRGGPGCVSFRRESMQARGGPDGGNGGKGGDVIIRTSRHINSLVDIRQNKRYAAQSGRMGEGRQKSGMDGEDLILIVPQGTVFRNMDGEIIIDMTGISEHTLLKGGRGGKGNEFFKNSVNQAPEHAQPGEEGQEIEVRLELKLIADVGIVGFPNAGKSTLISRISAARPKIADYPFTTLTPNLGVVKAGDYSSFVVADIPGLVKGAHAGVGLGIQFLKHIERTRLFIHLVDASGMSGRDPLEDYTDINNELKMYDENNQDKEGFFPLSTRPQLVVLNKIDTLSESQLTKLKKQFKEASGSEPFAISAVTGKNIKEFVQELARQILKEEEE",
        "proteome": "UP000008080",
        "gene": "obg",
        "go_terms": [
            {
                "identifier": "GO:0005525",
                "name": "GTP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000287",
                "name": "magnesium ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003924",
                "name": "GTPase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6851410a70aa2adef8568c6970f68d2d6f93e0dd",
        "counters": {
            "domain_architectures": 19553,
            "entries": 26,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "profile": 2,
                "ssf": 2,
                "pfam": 2,
                "cdd": 1,
                "ncbifam": 4,
                "pirsf": 1,
                "panther": 1,
                "hamap": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 19553
        }
    }
}