HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q6MGS5",
"id": "OBG_BDEBA",
"source_organism": {
"taxId": "264462",
"scientificName": "Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)",
"fullName": "Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)"
},
"name": "GTPase Obg",
"description": [
"An essential GTPase which binds GTP, GDP and possibly (p)ppGpp with moderate affinity, with high nucleotide exchange rates and a fairly low GTP hydrolysis rate. Plays a role in control of the cell cycle, stress response, ribosome biogenesis and in those bacteria that undergo differentiation, in morphogenesis control"
],
"length": 343,
"sequence": "MKFIDEVSISLASGRGGPGCVSFRRESMQARGGPDGGNGGKGGDVIIRTSRHINSLVDIRQNKRYAAQSGRMGEGRQKSGMDGEDLILIVPQGTVFRNMDGEIIIDMTGISEHTLLKGGRGGKGNEFFKNSVNQAPEHAQPGEEGQEIEVRLELKLIADVGIVGFPNAGKSTLISRISAARPKIADYPFTTLTPNLGVVKAGDYSSFVVADIPGLVKGAHAGVGLGIQFLKHIERTRLFIHLVDASGMSGRDPLEDYTDINNELKMYDENNQDKEGFFPLSTRPQLVVLNKIDTLSESQLTKLKKQFKEASGSEPFAISAVTGKNIKEFVQELARQILKEEEE",
"proteome": "UP000008080",
"gene": "obg",
"go_terms": [
{
"identifier": "GO:0005525",
"name": "GTP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000287",
"name": "magnesium ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003924",
"name": "GTPase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6851410a70aa2adef8568c6970f68d2d6f93e0dd",
"counters": {
"domain_architectures": 19553,
"entries": 26,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"profile": 2,
"ssf": 2,
"pfam": 2,
"cdd": 1,
"ncbifam": 4,
"pirsf": 1,
"panther": 1,
"hamap": 1,
"prints": 1,
"prosite": 1,
"interpro": 8
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 19553
}
}
}