General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q6JT77",
        "id": "Q6JT77_DANRE",
        "source_organism": {
            "taxId": "7955",
            "scientificName": "Danio rerio",
            "fullName": "Danio rerio (Zebrafish)"
        },
        "name": "Proenkephalin-B",
        "description": [
            "Dynorphin peptides differentially regulate the kappa opioid receptor. Dynorphin A(1-13) has a typical opioid activity, it is 700 times more potent than Leu-enkephalin",
            "Leu-enkephalins compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress",
            "Leumorphin has a typical opioid activity and may have anti-apoptotic effect"
        ],
        "length": 252,
        "sequence": "MEWYVLVLMLSFPTLSQADCSAQCLRCAQQISDLDSAVNRLTCTLECEGAVPPTGTLDRCEKALQGLSDDLAELNTGADGETNALNTDEDLQEKTSNLVKRYGGFIKRIDKNKNKFFSSPWKENAILKGLFAKKYGESLSKLGERDLPSITEDDEGEDMGAENETGVYDNEVPLNEVKRYGGFLRKFGPKRSYFVDDTNPQVLQKRYGGFMRRIRPKLRWDNQKRYGGFLRRHFKISVRSDEEPSSYEDYAL",
        "proteome": "UP000000437",
        "gene": "pdyn",
        "go_terms": [
            {
                "identifier": "GO:0007218",
                "name": "neuropeptide signaling pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6fa08cbd40ae6cd5bb2038f6d2313e3785d0712e",
        "counters": {
            "domain_architectures": 2355,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "prints": 2,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2355
        }
    }
}