HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q6JHX0",
"id": "Q6JHX0_BUTJA",
"source_organism": {
"taxId": "56263",
"scientificName": "Buteo jamaicensis",
"fullName": "Buteo jamaicensis (Red-tailed hawk)"
},
"name": "V(D)J recombination-activating protein 1",
"description": [
"Catalytic component of the RAG complex, a multiprotein complex that mediates the DNA cleavage phase during V(D)J recombination. V(D)J recombination assembles a diverse repertoire of immunoglobulin and T-cell receptor genes in developing B and T-lymphocytes through rearrangement of different V (variable), in some cases D (diversity), and J (joining) gene segments. In the RAG complex, RAG1 mediates the DNA-binding to the conserved recombination signal sequences (RSS) and catalyzes the DNA cleavage activities by introducing a double-strand break between the RSS and the adjacent coding segment. RAG2 is not a catalytic component but is required for all known catalytic activities. DNA cleavage occurs in 2 steps: a first nick is introduced in the top strand immediately upstream of the heptamer, generating a 3'-hydroxyl group that can attack the phosphodiester bond on the opposite strand in a direct transesterification reaction, thereby creating 4 DNA ends: 2 hairpin coding ends and 2 blunt, 5'-phosphorylated ends"
],
"length": 945,
"sequence": "KVRSFEKRLSDDSQHINKDQVEEVTSSSKEIILHKDEAVPRGEKMDLMGNRQXLEKDANDMQTEDNKAHQNNLKQLCRICGVSFKTDCYKRSHPVHGPVDDETLWLLRKKEKKATSWPDLIAKVFKIDVRGDVDTIHPTQFCHNCWTIIHRKFSNTPCEVYFPRNGTMEWQPHSPNCAVCHTTKRGVKRKSQPPRVQHGKRVKTVAERARINRGVKNQAQINNKNLVKEIVNCKNIHLSTKLLAVDYPVDFIKSISCQICEHILADPVETTCRHLFCRICILKCIKVMGSYCPSCWYPCFPTDLVTPVKSFLNILDSLGIRCPVKECDEEILHGKYGQHLSSHKEMKEKEPYSHVNKGGRPRQHLLSLTRRAQKHRLRELKRQVKAFAEKEEGGDIKAVCMTLFLLALRAKNEHRQADELEAIMQGRGSGLHPAVCLAIRVNTFLSCSQYHKMYRTVKAVTGRQIFQPLHALRTAEKALLPGYHPFEWKPPLKNVSTNTEVGIIDGLSGLPLSIDDYPVDTIAKRFRYDAALVCALKDMEEEILEGMKAKNLDDYLNGPFTVVVKESCDGMGDVSEKHGNGPAVPEKAVRFSFTVMNIAIAHGNESKRIFEEVKPNSELCCKPLCLMLADESDHETLTAILSPLIAEREAMKNSELLLEMGGILRTFKFIFRGTGYDEKLVREVEGLEASGSTYICTLCDATRLEASQNLVFHSITRSHAENLERYEIWRSNPYHESVDELRDRVKGVSAKPFIETVPSIDALHCDIGNATEFYRIFQMEIGEVYKNPDVSKEERKRWQLILDKHLRKKMNLKPMMRMSGNFARKLMSKETVEAVCELIKCEERHEALKELMDLYLKMKPVWRSSCPAKECPELLCQYSYNSQRFAELLSTKFKYRYEGKITNYFHKTLAHVPEIIERDGSIGAWASEGNESGNKLFRRFRKMNA",
"proteome": null,
"gene": null,
"go_terms": [
{
"identifier": "GO:0046872",
"name": "metal ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004519",
"name": "endonuclease activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0043565",
"name": "sequence-specific DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0061630",
"name": "ubiquitin protein ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0033151",
"name": "V(D)J recombination",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "6ee2450311170dd9e1c253053c6453a9993f02cd",
"counters": {
"domain_architectures": 2309,
"entries": 38,
"isoforms": 0,
"proteomes": 0,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cathgene3d": 3,
"cdd": 1,
"pfam": 10,
"smart": 1,
"profile": 3,
"panther": 1,
"prosite": 1,
"interpro": 16
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 2309
}
}
}