GET /api/protein/UniProt/Q6IQ69/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q6IQ69",
        "id": "MYMK_DANRE",
        "source_organism": {
            "taxId": "7955",
            "scientificName": "Danio rerio",
            "fullName": "Danio rerio (Zebrafish)"
        },
        "name": "Protein myomaker",
        "description": [
            "Myoblast-specific protein that mediates myoblast fusion, an essential step for the formation of multi-nucleated muscle fibers (PubMed:25078621, PubMed:28161523, PubMed:28681861, PubMed:30016436). Actively participates in the membrane fusion reaction by mediating the mixing of cell membrane lipids (hemifusion) upstream of mymx (By similarity)"
        ],
        "length": 220,
        "sequence": "MGAFIAKMLLPTISSLVFVPAASVAAKRGFHMEAMVYFFTMFFTAIYHACDGPGLSILCFMKYDILEYFSVYGTAISMWVTLLALGDFDEPKRSSLTMFGVLTAAVRIYQDRLGYGIYSGPIGTAVFMITVKWLQKMKEKKGLYPDKSVYTQQVGPGCCFGALALMLRFYFEEWDYAYVHSFYHVSLAMSFILLLPKKNRYAGTGRNAAKLNCYTLCCCV",
        "proteome": "UP000000437",
        "gene": "mymk",
        "go_terms": [
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "983bcb3b94e953cac42496eab1b97aa723150ed9",
        "counters": {
            "domain_architectures": 4731,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4731
        }
    }
}