GET /api/protein/UniProt/Q6I5L0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q6I5L0",
"id": "Q6I5L0_ORYSJ",
"source_organism": {
"taxId": "39947",
"scientificName": "Oryza sativa subsp. japonica",
"fullName": "Oryza sativa subsp. japonica (Rice)"
},
"name": "3-hydroxyacyl-[acyl-carrier-protein] dehydratase",
"description": [
"Involved in unsaturated fatty acids biosynthesis. Catalyzes the dehydration of short chain beta-hydroxyacyl-ACPs and long chain saturated and unsaturated beta-hydroxyacyl-ACPs"
],
"length": 215,
"sequence": "METAAMPRSPCCSLPSARVLPSRLPLLPRPAPAALSAPAARPVVARCAAAAGHGGEGEMPIEKRFPPFPAVMDINQIRDILPHRFPFLLVDRVIDYKPGEYAVGIKNVTINDNFFPGHFPERPIMPGVLMVEAMAQVGGLVMLQPEVGGSRENFFFAGIDKVRFRKPVIAGDTLIIRMTLIKLQKRFGIAKMEGKAYVGGDLVCEGEFLMATGSE",
"proteome": "UP000059680",
"gene": "Os05g0435700",
"go_terms": [
{
"identifier": "GO:0016836",
"name": "hydro-lyase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006633",
"name": "fatty acid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 1,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6eee872930b0f833d0a363bc10e4597494e29e33",
"counters": {
"domain_architectures": 27313,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"cdd": 1,
"panther": 1,
"ncbifam": 2,
"hamap": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 27313
}
}
}