GET /api/protein/UniProt/Q6HDT8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q6HDT8",
"id": "GCSPB_BACHK",
"source_organism": {
"taxId": "281309",
"scientificName": "Bacillus thuringiensis subsp. konkukian (strain 97-27)",
"fullName": "Bacillus thuringiensis subsp. konkukian (strain 97-27)"
},
"name": "Probable glycine dehydrogenase (decarboxylating) subunit 2",
"description": [
"The glycine cleavage system catalyzes the degradation of glycine. The P protein binds the alpha-amino group of glycine through its pyridoxal phosphate cofactor; CO(2) is released and the remaining methylamine moiety is then transferred to the lipoamide cofactor of the H protein"
],
"length": 491,
"sequence": "MKNQDQALIFEVSKEGRIGYSLPKLDVEEVKLEDVFESDYIRVEDAELPEVSELDIMRHYTALSNRNHGVDSGFYPLGSCTMKYNPKINESVARFAGFANIHPLQDEKTVQGAMELMYDLQEHLIEITGMDTVTLQPAAGAHGEWTGLMLIRAYHEANGDFNRTKVIVPDSAHGTNPASATVAGFETITVKSNEHGLVDLEDLKRVVNEETAALMLTNPNTLGLFEENILEMAEIVHNAGGKLYYDGANLNAVLSQARPGDMGFDVVHLNLHKTFTGPHGGGGPGSGPVGVKADLIPYLPKPILEKTENGYHFNYDRPEAIGRVKPFYGNFGINVRAYTYIRSMGPDGLRAVTEYAVLNANYMMRRLAPFYDLPFDRHCKHEFVLSGRRQKKLGVRTLDIAKRLLDFGYHPPTIYFPLNVEECIMIEPTETESKETLDGFIDKMIQIAKEVEENPEVVQEAPHTTVIKRLDETMAARKPVLRYAKPAPVQV",
"proteome": null,
"gene": "gcvPB",
"go_terms": [
{
"identifier": "GO:0004375",
"name": "glycine dehydrogenase (decarboxylating) activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006546",
"name": "glycine catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0019464",
"name": "glycine decarboxylation via glycine cleavage system",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1af63f59835630cc23ab665db7dd40eb143df968",
"counters": {
"domain_architectures": 4440,
"entries": 17,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 3,
"ssf": 1,
"pfam": 2,
"cdd": 1,
"ncbifam": 1,
"hamap": 1,
"panther": 1,
"interpro": 7
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 4440
}
}
}