General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q6HC24",
        "id": "Q6HC24_BACHK",
        "source_organism": {
            "taxId": "281309",
            "scientificName": "Bacillus thuringiensis subsp. konkukian (strain 97-27)",
            "fullName": "Bacillus thuringiensis subsp. konkukian (strain 97-27)"
        },
        "name": "1,4-dihydroxy-2-naphthoate octaprenyltransferase",
        "description": [
            "Conversion of 1,4-dihydroxy-2-naphthoate (DHNA) to demethylmenaquinone (DMK)"
        ],
        "length": 317,
        "sequence": "MEMNVETNSSPTAPKPSKQTGWRIWWSLLRPHTLTAAFVPVFIGTAYAMQVGGINQIHLPLFLIMLLACLLIQAATNMFNEYFDYKRGLDHEGSVGIGGAIVRDGIQPKTVLNLAFGFFGIAILLGVYICMNSSWWLAAIGLVCMAVAYLYTGGPLPIAYTPFGELTAGLFMGVIIIGISFFIQTGTVTSEVVLLSIPSSILIGAILLANNIRDLDGDKENGRKTLAILVGRERAVGVLASMFIVSYIWTIALIIVGIVSPWMLIVFLSAPKAFKATKGFIGKSIPMEMVPAMIATAKTNTIFGLLMGIGLLLGYFL",
        "proteome": null,
        "gene": "menA",
        "go_terms": [
            {
                "identifier": "GO:0004659",
                "name": "prenyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046428",
                "name": "1,4-dihydroxy-2-naphthoate polyprenyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009234",
                "name": "menaquinone biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016765",
                "name": "transferase activity, transferring alkyl or aryl (other than methyl) groups",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1ef8fd2ce97f2751111ca5e0efe0086d9a133586",
        "counters": {
            "domain_architectures": 88233,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "cathgene3d": 1,
                "ncbifam": 2,
                "panther": 1,
                "hamap": 1,
                "pirsf": 1,
                "pfam": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 88233
        }
    }
}